The heart's own pressure-release hormones — a diagnostic revolution, a cautionary drug-development story, and no research-peptide scene at all, for reasons this guide explains.
The natriuretic peptides are hormones the heart releases when its walls are stretched — a built-in pressure-relief system that tells the kidneys to excrete sodium and water, relaxes blood vessels, and pushes back against the renin-angiotensin-aldosterone system. They are among the most consequential peptide discoveries of the twentieth century, though not for the reason drug developers hoped.
The field began in 1981, when de Bold and colleagues showed that injecting atrial tissue extract into rats produced a flood of sodium excretion — proving the heart is an endocrine organ (PMID 7219045). The peptide responsible, ANP (atrial natriuretic peptide, 28 amino acids: SLRRSSCFGGRMDRIGAQSGLGCNSFRY), was sequenced in 1983 (PMID 6230081). BNP followed in 1984 to 1988, first isolated from porcine brain (PMIDs 6230082, 2964562) — which saddled it with the name "brain natriuretic peptide." In humans, BNP (32 amino acids: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH) is made overwhelmingly by the heart's ventricles, so the letter now officially stands for B-type. A third family member, CNP (PMID 2139780), works mainly as a local vessel and growth-plate signal rather than a circulating hormone.
A laboratory detail that runs the whole clinical story: when the heart releases BNP, it splits a precursor into active BNP plus an inactive fragment, NT-proBNP. The fragment circulates much longer, so both are measured as blood tests — and they are not interchangeable numbers.
Endogenous hormones and hospital drugs, not research peptides. The drug forms (nesiritide, carperitide) are intravenous, prescription-only, and covered here as evidence and context — dosing decisions belong to the treating team.
ANP and BNP bind the NPR-A receptor on blood vessels and kidneys. The receptor is itself an enzyme — a membrane guanylate cyclase — and generates cGMP inside the cell. The result: smooth-muscle relaxation and vasodilation, increased sodium and water excretion, and reduced sympathetic and aldosterone drive. It is a coherent, whole-system counterweight to the hormones that raise blood pressure and retain fluid.
Two systems erase these peptides within minutes: the NPR-C clearance receptor, which internalises and destroys them, and the enzyme neprilysin, which cuts them apart. Short half-life is a design feature of a minute-to-minute pressure control system — and, as the sourcing section of this guide explains, it is also why no oral or injectable self-administered version of these peptides can exist in any practical sense.
Blocking neprilysin raises natriuretic peptide levels — the principle behind the heart-failure drug sacubitril (combined with valsartan as an ARNI). The trade-off lands on the blood test: sacubitril raises measured BNP (BNP is a neprilysin substrate) but not NT-proBNP, so patients on an ARNI are followed with NT-proBNP. A rising BNP on sacubitril can mean the drug is working, not that the heart is failing.
The natriuretic peptides' real clinical triumph is measurement, not infusion. A stretched, failing heart announces itself in the blood before almost anything else does, and three landmark studies set the numbers still used in emergency departments.
The Breathing Not Properly study (Maisel et al. 2002, PMID 12124404) measured BNP in 1,586 patients presenting with breathlessness. A cut-off of 100 pg/mL identified heart failure with 83.4 percent diagnostic accuracy, and a value below 50 pg/mL carried a 96 percent negative predictive value — a low BNP effectively excluded heart failure as the cause. The PRIDE study (2005, PMID 15820160) did the same work for NT-proBNP in 600 patients: it was the strongest single predictor of acute heart failure (odds ratio 44), and a value under 300 pg/mL excluded the diagnosis with a 99 percent negative predictive value. The ICON collaboration (2006, PMID 16293638) pooled 1,256 patients and produced the age-stratified NT-proBNP cut-offs in routine use today — 450, 900 and 1,800 pg/mL for patients under 50, 50 to 75, and over 75 — with the under-300 rule-out holding a 98 percent negative predictive value. Natriuretic peptide testing is embedded in the 2022 AHA/ACC/HFSA heart failure guideline (PMID 35363499).
Two confounders every reader of their own lab result should know: obesity lowers natriuretic peptide levels (a genuinely failing heart can produce a deceptively modest BNP in a patient with high body mass), and kidney failure raises them, NT-proBNP more than BNP, because clearance falls. The number is a probability input for a clinician, not a verdict — which is precisely how the trials above validated it.
Build your protocol, log every dose, monitor your body's response, and get reminders so you never miss a dose.
Start Tracking FreeIf measuring these peptides is a triumph, infusing them is the cautionary tale. The logic seemed airtight — a failing heart wants more of this signal; supply it as a drug. Two synthetic versions reached approval: nesiritide (recombinant BNP, FDA-approved 2001 as Natrecor) and carperitide (recombinant ANP, approved in Japan in 1995). Here is what the trials found, in the order the evidence arrived.
Early haemodynamic wins. Nesiritide lowered pulmonary capillary wedge pressure — the congestion number — more than placebo and at least as much as nitroglycerin: in the VMAC trial (489 patients, PMID 11911755), wedge pressure fell 5.8 mmHg on nesiritide versus 3.8 on nitroglycerin and 2.0 on placebo at three hours, and an earlier trial (PMID 10911006) found 60 to 67 percent of nesiritide patients reporting improved global status versus 14 percent on placebo. Pressure numbers and symptom scores moved. That was enough for approval — in the era before outcome trials were demanded.
The safety scares. Meta-analyses in 2005 pooled the small trials and found signals the field could not ignore: worsening renal function (relative risk 1.52, PMID 15781736) and a mortality trend of 7.2 versus 4.0 percent (relative risk 1.74, p=0.059, PMID 15840865) — a trend, not a statistically confirmed effect, and one the small-trial record could neither confirm nor clear.
The definitive answer (ASCEND-HF, 2011, PMID 21732835). The 7,141-patient trial the controversy forced: nesiritide versus placebo in acute heart failure. The composite of heart-failure rehospitalisation or death was 9.4 versus 10.1 percent (p=0.31) — no benefit. Breathlessness improvement missed the trial's own prespecified significance threshold. Death (3.6 versus 4.0 percent) and renal dysfunction (31.4 versus 29.5 percent) were not significantly different — ASCEND-HF cleared nesiritide of the mortality charge and convicted it of ineffectiveness in the same result. A drug that is safe and does not work is still a drug that does not work.
The ANP side of the family. Anaritide, a synthetic ANP analogue, was tested not in heart failure but in acute tubular necrosis — kidney failure — in 504 patients (Allgren et al. 1997, PMID 9062091). Overall result: negative (dialysis-free survival 43 versus 47 percent, p=0.35). A subgroup not producing urine appeared to benefit strikingly (27 versus 8 percent, p=0.008) while the non-oliguric subgroup did worse on treatment — the classic profile of a subgroup mirage, and the confirmatory trial in the favourable subgroup (222 patients, PMID 11007679) was again negative (21 versus 15 percent, p=0.22), with blood pressure under 90 mmHg in 95 percent of treated patients versus 55 percent on placebo. Carperitide in Japan followed a different path: approved in 1995 without a large double-blind outcome trial, ever. Its best-known randomised study, J-WIND (2007, PMID 17964349), gave carperitide at 0.025 mcg/kg/min for three days after heart attack in about 570 patients and reported infarct size 14.7 percent smaller — alongside severe hypotension in 29 treated patients versus 1 control. The largest carperitide dataset is an uncontrolled surveillance study of 3,777 patients (PMID 15731532), in which 82 percent were judged improved — a design that cannot separate drug effect from natural recovery — and a small 49-patient trial (PROTECT, PMID 18812677) reported fewer deaths and rehospitalisations at 18 months (11.5 versus 34.8 percent, p=0.0359), a hypothesis-generating result never confirmed at scale. The family's last big test, the urodilatin trial TRUE-AHF (2,157 patients, PMID 28402745), was neutral on cardiovascular death (hazard ratio 1.03).
The pattern across four molecules and three decades is consistent: natriuretic peptides move pressure numbers reliably and hard outcomes barely or not at all. That is the record any honest account of "BNP therapy" has to start from.
Not medical advice. These are prescription medications. The figures below describe established clinical practice and labelled prescribing information — they are not a recommendation, they do not account for your labs, history, or other medications, and safe use depends on monitoring a page cannot do. Work with a qualified healthcare provider.
Carperitide, in its Japanese trials and practice, is likewise a continuous IV infusion — 0.025 mcg/kg/min in the J-WIND trial (PMID 17964349), a median of 0.085 mcg/kg/min for a median 65 hours in the national surveillance cohort (PMID 15731532). These figures are reported here as the published record of how the drugs were used in monitored settings, not as a regimen for anyone to follow: both drugs exist to be titrated against a blood pressure cuff by a treating team.
Most compounds in this library have a community-use scene this guide can describe and critique. ANP and BNP do not, and the absence is structural, not a gap in our research. These peptides are cleared from blood within minutes by a dedicated clearance receptor and by neprilysin; the only formulations that have ever worked are continuous intravenous infusions in hospitals. There is no vial-and-syringe protocol, no oral form, and no grey-market practice of any scale — a peptide with a minutes-long half-life and a blood-pressure-lowering effect is a monitored drug, full stop. Anyone selling "BNP" for self-administration is selling something that cannot do what the label implies.
Pre-filled with a typical ANP & BNP (Natriuretic Peptides) setup. Edit any field — the draw updates live.
Insulin syringe — 100 units = 1 mL
Free account. Saves your reconstitution + schedules doses + tracks every vial.
Dosing cheat sheet, reconstitution reference, and cycle planning — delivered to your inbox.
The dose-limiting effect of every infused natriuretic peptide is blood pressure. In J-WIND, severe hypotension occurred in 29 carperitide patients versus 1 control (PMID 17964349); in the anaritide confirmatory trial, systolic pressure under 90 mmHg was recorded in 95 percent of treated patients (PMID 11007679); Japan's carperitide surveillance reported adverse events in 16.9 percent, led by blood-pressure lowering at 9.5 percent (PMID 15731532). These are vasodilators given to people whose circulation is already compromised — the monitoring is the treatment.
The 2005 meta-analytic renal signal (relative risk 1.52, PMID 15781736) was not confirmed as a significant effect in ASCEND-HF's 7,141 patients (renal dysfunction 31.4 versus 29.5 percent, not significant; PMID 21732835). The accurate statement is that small trials raised a concern and the one adequately powered trial did not substantiate it — the same trial that removed the drug's reason to exist by showing no outcome benefit.
Natrecor (nesiritide) is no longer marketed: the manufacturer discontinued it (reported in 2018). It was not withdrawn by the FDA for safety reasons — a distinction worth keeping, because "pulled for safety" is the version that circulates. It left the market as a commercially dead drug after a neutral mega-trial, which is a quieter and more instructive ending. Carperitide remains a Japanese hospital product.
ANP & BNP (Natriuretic Peptides) is a prescription medication. StackTrax does not sell, prescribe, or facilitate purchase of prescription drugs.
Find a clinician who can order baseline lab work, screen for contraindications, monitor your response, and adjust dosing over time. Options to consider:
Before starting, you’ll typically want:
Avoid sources that offer prescription medications without labs, medical history, or licensed-provider oversight. If a telehealth service promises a prescription after a 5-minute questionnaire, that’s a red flag.
Build your protocol, log every dose, monitor your body's response, and get reminders so you never miss a dose.
Start Tracking FreeBoth are natriuretic hormones released by the stretched heart, acting on the same NPR-A receptor. ANP (28 amino acids) comes mainly from the atria and was discovered first (PMID 7219045). BNP (32 amino acids in humans) comes mainly from the ventricles; it was first isolated from pig brain, which is why older sources call it brain natriuretic peptide — the B now stands for B-type. BNP and its fragment NT-proBNP became the standard blood tests because they rise higher and circulate longer.
It means the heart wall is under strain, and it makes heart failure substantially more likely — but it is a probability, not a diagnosis. The validated uses are rule-out and rule-in thresholds: NT-proBNP under 300 pg/mL excluded acute heart failure with 99% negative predictive value in the PRIDE study (PMID 15820160), and age-stratified cut-offs of 450/900/1,800 pg/mL came from the ICON collaboration (PMID 16293638). Kidney failure pushes values up and obesity pushes them down, so the number is interpreted by a clinician alongside the examination — never by the patient alone.
It lowered congestion pressures and improved symptom scores in early trials (PMIDs 11911755, 10911006), which won approval in 2001. The definitive 7,141-patient ASCEND-HF trial then found no benefit on death or heart-failure rehospitalisation (9.4% vs 10.1%, p=0.31) and no significant renal harm either (PMID 21732835). The manufacturer later discontinued it for commercial reasons; it was not withdrawn by the FDA for safety.
There is no legitimate version of this. ANP and BNP are destroyed in the bloodstream within minutes by a clearance receptor and the enzyme neprilysin; the only formulations ever used clinically are continuous IV infusions in hospitals, titrated against blood pressure — hypotension is their dominant adverse effect (29 severe cases vs 1 control in one carperitide trial, PMID 17964349). No oral, subcutaneous, or community protocol exists, and a vial sold for self-use cannot reproduce the hospital exposure even in principle.
If you take sacubitril/valsartan (an ARNI), sacubitril blocks neprilysin — one of the enzymes that clears BNP. Measured BNP therefore rises on the drug without the heart getting worse, while NT-proBNP, which is not cleared by neprilysin, stays interpretable. That is why patients on an ARNI are monitored with NT-proBNP.
They are real endogenous peptide hormones, but they sit at the opposite end of the spectrum from the research-compound scene: prescription hospital drugs and laboratory diagnostics with large randomised trials, regulatory approvals, and — for the drug use — a well-documented record of neutral outcomes. Their story is included in this library because it is the clearest case study available of the gap between a beautiful mechanism and a clinical result.
Disclaimer: This guide is for educational and informational purposes only and is not intended as medical advice, diagnosis, or treatment. The compounds discussed are not FDA approved for human use. Always consult a qualified healthcare provider before starting any new supplement or peptide protocol. StackTrax does not sell peptides or supplements directly — purchase links go to third-party vendors. StackTrax is not responsible for the products, quality, or business practices of any third-party vendor.
© 2026 StackTrax, LLC. All rights reserved.
Privacy · Terms · Do Not Sell or Share My Personal Information
StackTrax guides cover peptides and compounds that are not FDA-approved for the uses discussed. The dosing, reconstitution, and safety information is compiled from published research and community protocols for educational purposes only.
Before using any compound mentioned here, consult a qualified healthcare provider. StackTrax does not sell, prescribe, or recommend these substances for personal use.